PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Tp57577_TGAC_v2_mRNA16832
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Trifolium
Family G2-like
Protein Properties Length: 370aa    MW: 41899.5 Da    PI: 8.2884
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Tp57577_TGAC_v2_mRNA16832genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like53.26.5e-173193502556
                    G2-like  25 ekAtPktilelmkvkgLtlehvkSHLQkYRla 56 
                                + AtPk+i+elm+v+gLt+++vkSHLQkYRl+
  Tp57577_TGAC_v2_mRNA16832 319 KTATPKQIRELMQVDGLTNDEVKSHLQKYRLH 350
                                78****************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466895.55E-7317353IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.605.8E-15319354IPR009057Homeodomain-like
TIGRFAMsTIGR015571.0E-13319350IPR006447Myb domain, plants
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 370 aa     Download sequence    Send to blast
MGCVVPSELS LELRPTFVPK TIANFLYHLS TLQNTSDKLS KLHDFVSRFE EELNKIQAFK  60
RELPLCMLLL IDAISVLKEE LEKCRTQNSV PVLEEFIPLK KEIDQSQENN NNDDRENNNN  120
NECRDKKNWM SSVQLWNNNT TTNNNVVDHD KHNNNHNKLE TKKRDEEGQS MTIAEETFQS  180
CSSNRNGGSA FMPFSTYSSV PVTTVKLSAP KEEKEETVMN GFSLLSSGVK SLREGFGSKG  240
SKSSSNRAVS SSPPTVQPSL RTPPLQPQQT SRKXXXXXXX XXXXXRLNCT GDLSMHCRSL  300
EVLKISKWMD VLEVNANLKT ATPKQIRELM QVDGLTNDEV KSHLQKYRLH TRRIGVEEMG  360
MKIILSVTK*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013456887.11e-145myb-like transcription factor family protein
TrEMBLA0A072UPI81e-145A0A072UPI8_MEDTR; Myb-like transcription factor family protein
STRINGVIT_03s0063g01060.t011e-95(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF120834107
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G37180.12e-18G2-like family protein